Browse

Here you can browse and filter data by using advanced criteria.
Experimental data is grouped by peptide sequence.
Add
Please click on the 'Add' button to insert a new filter criterion.

  • 1 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL No. of experiments: 7
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      E. coli ATCC 25922
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa ATCC 27853
      Crystal violet assay
    • Preformed biofilm
      S. aureus ATCC 25923
      Crystal violet assay
    • Preformed biofilm
      E. faecium ATCC 19434
      Crystal violet assay
    • Preformed biofilm
      P. acnes ATCC 6919
      Crystal violet assay
    • Preformed biofilm
      E. coli O-157 / ATCC 43895
      Crystal violet assay
    • Preformed biofilm
      S. mutans Clarke UA159 / ATCC 700610
      Confocal microscopy-fluorescence
  • 2 LL-37 [LL-37, 37 aa] No. of experiments: 30
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Confocal microscopy-fluorescence
    • Adhesion (1-2h)
      P. aeruginosa
      Crystal violet assay
    • Adhesion (1-2h)
      S. epidermidis ATCC 35984
      Crystal violet assay
    • Formation (3-24h)
      S. epidermidis ATCC 35984
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay
    • Preformed biofilm
      B. pseudomallei
      Total countable CFUs
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Formation (3-24h)
      F. tularensis novicida (BEI NR-13)
      OD600,Crystal violet assay
    • Formation (3-24h)
      S. epidermidis ATCC 35984
      Crystal violet assay
    • Adhesion (1-2h)
      S. epidermidis ATCC 35984
      Crystal violet assay
    • Formation (3-24h)
      S. aureus ATCC 25923
      Crystal violet assay
    • Adhesion (1-2h)
      S. aureus ATCC 25923
      OD600
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Adhesion (1-2h)
      P. aeruginosa
      OD600
    • Formation (3-24h)
      P. aeruginosa
      OD600
    • Formation (3-24h)
      A. actinomycetemcomitans JP2
      Crystal violet assay
    • Formation (3-24h)
      A. actinomycetemcomitans Y4
      Crystal violet assay
    • Formation (3-24h)
      A. actinomycetemcomitans ATCC 29523
      Crystal violet assay
    • Formation (3-24h)
      A. actinomycetemcomitans NCTC 9710 / ATCC 33384
      Crystal violet assay
    • Formation (3-24h)
      A. actinomycetemcomitans VT726
      Crystal violet assay
    • Formation (3-24h)
      A. actinomycetemcomitans VT726 ltx-
      Crystal violet assay
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Adhesion (1-2h)
      C. albicans ATCC-SC5314
      XTT assay
    • Formation (3-24h)
      C. albicans ATCC-SC5314
      XTT assay
    • Formation (3-24h)
      C. albicans ATCC-SC5314
      XTT assay
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
    • Preformed biofilm
      B. thailandensis E264/ATCC 700388
      Crystal violet assay,OD600
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 3 BMAP-27 GRFKRFRKKFKKLFKKLSPVIPLLHL No. of experiments: 10
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Total countable CFUs
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Crystal violet assay,Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Total countable CFUs
  • 4 BMAP-28 GGLRSLGRKILRAWKKYGPIIVPIIRI No. of experiments: 26
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Total countable CFUs
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Crystal violet assay,Total countable CFUs
    • Preformed biofilm
      S. aureus
      Crystal violet assay,Total countable CFUs
    • Formation (3-24h)
      S. aureus Smith diffuse (SD)
      Crystal violet assay
    • Preformed biofilm
      S. aureus Smith diffuse (SD)
      Total countable CFUs
    • Formation (3-24h)
      S. aureus Smith diffuse (SD)
      Total countable CFUs
    • Preformed biofilm
      S. aureus ATCC 43300
      Total countable CFUs
    • Preformed biofilm
      E. faecalis ATCC 29212
      Total countable CFUs
    • Formation (3-24h)
      S. aureus ATCC 43300
      Total countable CFUs
    • Formation (3-24h)
      E. faecalis ATCC 29212
      Total countable CFUs
    • Adhesion (1-2h)
      C. albicans ATCC-SC5314
      XTT assay
    • Formation (3-24h)
      C. albicans ATCC-SC5314
      XTT assay
    • Formation (3-24h)
      C. albicans ATCC-SC5314
      XTT assay
    • Preformed biofilm
      C. albicans ATCC-SC5314
      XTT assay
    • Preformed biofilm
      C. albicans ATCC-SC5314
      XTT assay,Total countable CFUs
    • Preformed biofilm
      C. krusei
      XTT assay
    • Preformed biofilm
      C. glabrata
      XTT assay
  • 5 SMAP-29 RGLRRLGRKIAHGVKKYGPTVLRIIRIA No. of experiments: 14
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Total countable CFUs
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. aureus
      Crystal violet assay
    • Formation (3-24h)
      S. maltophilia
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay
    • Preformed biofilm
      P. aeruginosa
      Total countable CFUs
    • Preformed biofilm
      S. maltophilia
      Total countable CFUs
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
    • Preformed biofilm
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
  • 6 KSL KKVVFKVKFK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. mutans ATCC 25175
      Crystal violet assay
    • Preformed biofilm
      S. mutans ATCC 25175
      Crystal violet assay,Confocal microscopy-fluorescence
  • 7 F2,5,12W RWGRWLRKIRRWRPK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. epidermidis
      Crystal violet assay,Resazurin/AlamarBlue assay
    • Preformed biofilm
      S. epidermidis
      Resazurin/AlamarBlue assay,Crystal violet assay
  • 8 LL-31 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNL No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay
    • Preformed biofilm
      B. pseudomallei
      Total countable CFUs
  • 9 LL7-31 RKSKEKIGKEFKRIVQRIKDFLRNL No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 10 LL13-37 IGKEFKRIVQRIKDFLRNLVPRTES No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay
  • 11 LL7-37 RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay,Total countable CFUs
  • 12 LL-19 LLGDFFRKSKEKIGKEFKR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 13 LL-25 LLGDFFRKSKEKIGKEFKRIVQRIK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 14 LL-13 LLGDFFRKSKEKI No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 15 LL13-31 IGKEFKRIVQRIKDFLRNL No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 16 LL7-25 RKSKEKIGKEFKRIVQRIK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 17 LL13-25 IGKEFKRIVQRIK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 18 LL19-37 RIVQRIKDFLRNLVPRTES No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 19 KSL-W KKVVFWVKFK No. of experiments: 5
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      C. albicans ATCC-SC5314
      XTT assay
    • Preformed biofilm
      C. albicans ATCC-SC5314
      XTT assay
    • Preformed biofilm
      S. aureus
      Total countable CFUs
    • Preformed biofilm
      S. epidermidis
      Total countable CFUs
    • Preformed biofilm
      A. baumannii
      Total countable CFUs
  • 20 KS-30 KSKEKIGKEFKRIVQRIKDFLRNLVPRTES No. of experiments: 3
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      A. baumannii
      Crystal violet assay
    • Formation (3-24h)
      A. baumannii
      Crystal violet assay
    • Preformed biofilm
      A. baumannii
      Crystal violet assay

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or giuseppe.maccari@iit.it