Browse

Here you can browse and filter data by using advanced criteria.
Experimental data is grouped by peptide sequence.
Add
Please click on the 'Add' button to insert a new filter criterion.

  • 126 Citropin 1.1 GLFDVIKKVASVIGGL No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      S. aureus
      Total countable CFUs
  • 127 R-FV-I16 RFRRLFRIRVRVLKKI No. of experiments: 4
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Crystal violet assay
    • Formation (3-24h)
      E. coli ATCC 25922
      Crystal violet assay
    • Preformed biofilm
      E. coli ATCC 25922
      MTT assay
    • Preformed biofilm
      P. aeruginosa ATCC 27853
      MTT assay
  • 128 FV7 FRIRVRV No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      E. coli ATCC 25922
      Crystal violet assay
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Crystal violet assay
  • 129 VSL2 AFKAFWKFVKFVK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      E. faecalis
      Cell number/microscopy
  • 130 VS2 KWFWKFVKFVK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      E. faecalis
      Cell number/microscopy
  • 131 L-K6 IKKILSKIKKLLK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. mutans CGMCC 1.2500
      Crystal violet assay
    • Preformed biofilm
      S. mutans CGMCC 1.2500
      Crystal violet assay
  • 133 hLf1-11 GRRRRSVQWCA No. of experiments: 4
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      S. sanguinis
      Total countable CFUs
    • Adhesion (1-2h)
      L. salivarius
      Total countable CFUs
    • Formation (3-24h)
      S. sanguinis
      Luciferase
    • Formation (3-24h)
      S. salivarius
      Luciferase
  • 134 FS3 YAPWTNF No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus Smith diffuse (SD)
      Total countable CFUs
  • 135 Tet-213 KRWWKWWRRC No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
    • Adhesion (1-2h)
      S. aureus
      Total countable CFUs
  • 136 1010cys IRWRIRVWVRRIC No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
  • 137 Tet-20 KRWRIRVRVIRKC No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
  • 138 Tet-26 WIVVIWRRKRRRC No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
  • 139 FS8 YAPWTNA No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus Smith diffuse (SD)
      Total countable CFUs
  • 140 Chromofungin RILSILRHQNLLKELQDLAL No. of experiments: 3
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      C. albicans
      OD600
    • Adhesion (1-2h)
      N. crassa CBS 327-54
      Cell number/microscopy
    • Formation (3-24h)
      C. albicans
      Confocal microscopy-fluorescence
  • 142 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL No. of experiments: 4
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus
      WST-8
    • Formation (3-24h)
      P. aeruginosa
      WST-8
    • Formation (3-24h)
      E. coli
      WST-8
    • Formation (3-24h)
      B. subtilis
      WST-8
  • 144 Magainin I GIGLFLHSAGLFGLAFVGEIMKS No. of experiments: 3
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      L. iavanovii Li4pVS2
      Confocal microscopy-fluorescence,Total countable CFUs
    • Adhesion (1-2h)
      E. faecalis
      Total countable CFUs
    • Adhesion (1-2h)
      S. aureus ATCC 29213
      Total countable CFUs
  • 145 CysLasio-III CVNWKKILGKIIKVVK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      E. coli ATCC 8739
      XTT assay
    • Formation (3-24h)
      E. faecalis ATCC 29212
      XTT assay
  • 146 DASamP1 FFGKVLKLIRKIF No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. aureus USA300 LAC
      Total countable CFUs
  • 147 BMAP-18 GRWKRWRKKWKKLWKKLS No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      B. pseudomallei
      Crystal violet assay
  • 148 Bactenecin RLCRIVVIRVCR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      B. pseudomallei
      Crystal violet assay
  • 149 CA-MA KWKLFKKIGIGKFLHSAKKF No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      B. pseudomallei
      Crystal violet assay

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or giuseppe.maccari@iit.it