Browse

Here you can browse and filter data by using advanced criteria.
Experimental data is grouped by peptide sequence.
Add
Please click on the 'Add' button to insert a new filter criterion.

  • 200 P15-CSP GTPGPQGIAGQRGVVAEAAAKEAAAKEAAAKASGSLSTFFRLFNRSFTQALGK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
      Crystal violet assay
  • 201 C_AHA_Nt-Dhvar5 LLLFLLKKRKKRKY No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      S. aureus ATCC33591
      Confocal microscopy-fluorescence
    • Formation (3-24h)
      S. aureus ATCC33591
      Confocal microscopy-fluorescence
  • 202 C_ABA_Nt-Dhvar5 LLLFLLKKRKKRKY No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      S. aureus ATCC33591
      Confocal microscopy-fluorescence
  • 203 C_GG_Nt-Dhvar5 CGGLLLFLLKKRKKRKY No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Adhesion (1-2h)
      S. aureus ATCC33591
      Confocal microscopy-fluorescence
    • Formation (3-24h)
      S. aureus ATCC33591
      Confocal microscopy-fluorescence
  • 204 KT2 NGVQPKYKWWKWWKKWW No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      E. coli O-157 / ATCC 43895
      Confocal microscopy-fluorescence
  • 205 RT2 NGVQPKYRWWRWWRRWW No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      E. coli O-157 / ATCC 43895
      Confocal microscopy-fluorescence
  • 206 O-LF11-215 FWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay,MTT assay
  • 207 DI-MB-LF11-215 FWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      MTT assay,Total countable CFUs,Crystal violet assay
  • 208 6-MO-LF11-215 FWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay,MTT assay
  • 209 LF11-322 PFWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      MTT assay,Crystal violet assay
  • 210 DI-MB-LF11-322 PFWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay,MTT assay
  • 211 6-MO-LF11-322 PFWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      MTT assay,Crystal violet assay
  • 212 LF11-324 PFFWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay,MTT assay
  • 213 LF11-227 FWRRFWRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      MTT assay,Total countable CFUs,Crystal violet assay
  • 214 O-LF11-227 FWRRFWRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay,MTT assay
  • 215 6-MO-LF11-227 FWRRFWRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      MTT assay,Crystal violet assay
  • 216 LF11-215 FWRIRIRR No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      P. aeruginosa PAO1 / ATCC 15692
      Total countable CFUs,Crystal violet assay,MTT assay
  • 217 D-ATRA-1A krakkffkklk No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      Crystal violet assay,OD600
  • 218 ATRA-1A KRAKKFFKKLK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      Crystal violet assay,OD600
  • 219 ATRA-2 KRAKKFFKKPK No. of experiments: 2
    • ID
      Activity
      Organism
      Method
    • Preformed biofilm
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      Crystal violet assay,OD600
  • 220 ATRA-1 KRFKKFFKKLK No. of experiments: 1
    • ID
      Activity
      Organism
      Method
    • Formation (3-24h)
      B. thailandensis E264/ATCC 700388
      OD600,Crystal violet assay

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com