
Here you can browse and filter data by using advanced criteria.
Experimental data is grouped by peptide sequence.
Please click on the 'Add' button to insert a new filter criterion.

  • 84 CWR11 CWFWKWWRRRRR No. of experiments: 1
    • ID
    • Formation (3-24h)
      P. aeruginosa PAO1 / ATCC 15692
      Crystal violet assay
  • 85 Chrysophsin-1 FFGWLIKGAIHAGKAIHGLIHRRRH No. of experiments: 2
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
      Confocal microscopy-fluorescence
    • Preformed biofilm
      S. mutans Clarke UA159 / ATCC 700610
      Confocal microscopy-fluorescence
  • 86 RK1 RWKRWWRRKK No. of experiments: 3
    • ID
    • Formation (3-24h)
      E. coli ATCC 8739
      Crystal violet assay
    • Formation (3-24h)
      S. aureus ATCC 6538
      Crystal violet assay
    • Formation (3-24h)
      C. albicans ATCC 10231
      Crystal violet assay
  • 87 RK2 RKKRWWRRKK No. of experiments: 3
    • ID
    • Formation (3-24h)
      S. aureus ATCC 6538
      Crystal violet assay
    • Formation (3-24h)
      E. coli ATCC 8739
      Crystal violet assay
    • Formation (3-24h)
      C. albicans ATCC 10231
      Crystal violet assay
  • 88 (IRIK) 2 IRIKIRIK No. of experiments: 2
    • ID
    • Preformed biofilm
      S. aureus ATCC 29737
      XTT assay,Crystal violet assay
    • Preformed biofilm
      C. albicans
      Total countable CFUs
  • 89 (IRVK) 3 IRVKIRVKIRVK No. of experiments: 1
    • ID
    • Preformed biofilm
      S. aureus ATCC 29737
      XTT assay,Crystal violet assay
  • 90 PG-1 RGGRLCYCRRRFCVCVGR No. of experiments: 1
    • ID
    • Preformed biofilm
      C. neoformans B3501
      Total countable CFUs,XTT assay
  • 91 alpha-Defensin-3 DCYCRIPACIAGERRYGTCIYQGRLWAFCC No. of experiments: 1
    • ID
    • Preformed biofilm
      C. neoformans B3501
      XTT assay,Total countable CFUs
  • 92 beta-Defensin-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK No. of experiments: 1
    • ID
    • Preformed biofilm
      C. neoformans B3501
      XTT assay,Total countable CFUs
  • 94 Magainin-I GIGKFLHSAGKFGKAFVGEIMKS No. of experiments: 1
    • ID
    • Preformed biofilm
      C. neoformans B3501
      XTT assay,Total countable CFUs
  • 95 RIP YSPWTNF No. of experiments: 4
    • ID
    • Formation (3-24h)
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. aureus ATCC 43300
      Total countable CFUs
    • Formation (3-24h)
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. aureus Smith diffuse (SD)
      Total countable CFUs
  • 96 K4-S4(1–13)a ALWKTLLKKVLKA No. of experiments: 2
    • ID
    • Formation (3-24h)
      S. aureus
      Total countable CFUs
    • Formation (3-24h)
      S. aureus ATCC 43300
      Total countable CFUs
  • 97 DD13-RIP ALWKTLLKKVLKAYSPWTNF No. of experiments: 2
    • ID
    • Formation (3-24h)
      S. aureus ATCC 43300
      Total countable CFUs
    • Formation (3-24h)
      S. aureus
      Total countable CFUs
  • 98 Tachyplesin III KWCFRVCYRGICYRKCR No. of experiments: 2
    • ID
    • Adhesion (1-2h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
    • Formation (3-24h)
      P. aeruginosa ATCC 27853
      Total countable CFUs
  • 99 2C-4 RWRWRWF No. of experiments: 1
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
  • 100 Sm6(L1)2C FIKHFIHRFGGGRWRWRWF No. of experiments: 1
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
  • 101 Sm6(L3)2C FIKHFIHRFSATRWRWRWF No. of experiments: 1
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
  • 102 B-33 FKKFWKWFRRF No. of experiments: 1
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
  • 103 Sm6(L1)B33 FIKHFIHRFGGGFKKFWKWFRRF No. of experiments: 1
    • ID
    • Formation (3-24h)
      S. mutans Clarke UA159 / ATCC 700610
  • 104 PSN-1 FLSLIPHIVSGVASIAKHF No. of experiments: 1
    • ID
    • Preformed biofilm
      S. aureus ATCC 6538
  • 105 NRC-16 GWKKWLRKGAKHLGQAAIK No. of experiments: 1
    • ID
    • Formation (3-24h)
      P. aeruginosa
      Crystal violet assay

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: or