General


Name: LL7-37
Sequence: RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Size: 31
AMP source: modified
Notes:
Tags:

Peptide attributes


Name Value
NetCharge@5 7.447
NetCharge@7 6.979
Isoelectric Point 11.695
Molecular Weight 3798.226
Extinction Coefficient 0
Hydrophobicity (CCS) -3.129
Hydrophobic Mom (CCS) 3.902

Peptide experiments


Found 1 experiments
  • Microorganism
    Data
  • Pseudomonas aeruginosa PAO1 / ATCC 15692
    1

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or giuseppe.maccari@iit.it