General


Name: Melimine Cys13
Sequence: TLISWIKNKRKQCRPRVSRRRRRRGGRRRR
Size: 30
AMP source: modified
Notes:
Tags:

Peptide attributes


Name Value
NetCharge@5 16.038
NetCharge@7 15.945
Isoelectric Point 13.243
Molecular Weight 3887.332
Extinction Coefficient 5625
Hydrophobicity (CCS) -0.333
Hydrophobic Mom (CCS) 1.051

Peptide experiments


Found 2 experiments
  • Microorganism
    Data
  • Staphylococcus aureus
    1
  • Pseudomonas aeruginosa PAO1 / ATCC 15692
    1

References



M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com