General


Name: LL-37
Sequence: [LL-37, 37 aa]
Size: 37
AMP source: human
Notes:
Tags:

Peptide attributes


Name Value
NetCharge@5 6.521
NetCharge@7 5.98
Isoelectric Point 11.347
Molecular Weight 4490.58
Extinction Coefficient 0
Hydrophobicity (CCS) -1.846
Hydrophobic Mom (CCS) 3.748

Peptide experiments


Found 15 experiments
  • Microorganism
    Data
  • Pseudomonas aeruginosa
    7
  • Staphylococcus aureus
    2
  • Burkholderia pseudomallei
    1
  • Pseudomonas aeruginosa PAO1 / ATCC 15692
    2
  • Staphylococcus epidermidis ATCC 35984
    4
  • Staphylococcus aureus ATCC 25923
    2
  • Candida albicans ATCC-SC5314
    3
  • Aggregatibacter actinomycetemcomitans NCTC 9710 / ATCC 33384
    1
  • Francisella tularensis novicida (BEI NR-13)
    1
  • Aggregatibacter actinomycetemcomitans ATCC 29523
    1
  • Aggregatibacter actinomycetemcomitans JP2
    1
  • Aggregatibacter actinomycetemcomitans Y4
    1
  • Aggregatibacter actinomycetemcomitans VT726
    1
  • Aggregatibacter actinomycetemcomitans VT726 ltx-
    1
  • Burkholderia thailandensis E264/ATCC 700388
    2

References



M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or giuseppe.maccari@iit.it