General


Name: KS-30
Sequence: KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Size: 30
AMP source: modified
Notes:
Tags:

Peptide attributes


Name Value
NetCharge@5 6.447
NetCharge@7 5.979
Isoelectric Point 11.369
Molecular Weight 3642.125
Extinction Coefficient 0
Hydrophobicity (CCS) -2.9
Hydrophobic Mom (CCS) 3.985

Peptide experiments


Found 1 experiments
  • Microorganism
    Data
  • Acinetobacter baumannii
    3

M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or giuseppe.maccari@iit.it