General
Name: | LL-37 |
Sequence: | [LL-37, 37 aa] |
Size: | 37 |
AMP source: | human |
Notes: | |
Tags: |
Peptide attributes
Name | Value |
---|---|
NetCharge@5 | 6.521 |
NetCharge@7 | 5.98 |
Isoelectric Point | 11.347 |
Molecular Weight | 4490.58 |
Extinction Coefficient | 0 |
Hydrophobicity (CCS) | -0.116 |
Hydrophobic Mom (CCS) | 3.748 |
Peptide experiments
-
MicroorganismData
References
- Lilian S. Amer, Barney M. Bishop, Monique L. van Hoek Antimicrobial and antibiofilm activity of cathelicidins and short, synthetic peptides against Francisella
- Sakawrat Kanthawong, Jan G.M. Bolscher, Enno C.I. Veerman, Jan van Marle, Hans J.J. de Soet, Kamran Nazmi, Surasakdi Wongratanacheewin, Suwimol Taweechaisupapong Antimicrobial and antibiofilm activity of LL-37 and its truncated variants against Burkholderia pseudomallei
- Sibel Dosler, Elif Karaaslan Inhibition and destruction of Pseudomonas aeruginosa biofilms by antibiotics and antimicrobial peptides
- Michele Scarsini, Linda Tomasinsig, Alessandra Arzese, Francesca D’Este, Debora Oro, Barbara Skerlavaj Antifungal activity of cathelicidin peptides against planktonic and biofilm cultures of Candida species isolated from vaginal infections
- L. Segev-Zarko, Ron Saar-Dover, Vlad Brumfeld, Maria Luisa Mangoni, Yechiel Shai Mechanisms of biofilm inhibition and degradation by antimicrobial peptides
- Ã. Hell, C.G. Giske, A. Nelson, U. Römling, G. Marchini Human cathelicidin peptide LL37 inhibits both attachment capability and biofilm formation ofStaphylococcus epidermidis
- C. de la Fuente-Nunez, V. Korolik, M. Bains, U. Nguyen, E. B. M. Breidenstein, S. Horsman, S. Lewenza, L. Burrows, R. E. W. Hancock Inhibition of Bacterial Biofilm Formation and Swarming Motility by a Small Synthetic Cationic Peptide
- C. Nagant, B. Pitts, K. Nazmi, M. Vandenbranden, J. G. Bolscher, P. S. Stewart, J.- P. Dehaye Identification of Peptides Derived from the Human Antimicrobial Peptide LL-37 Active against Biofilms Formed by Pseudomonas aeruginosa Using a Library of Truncated Fragments
- E. M. Haisma, A. de Breij, H. Chan, J. T. van Dissel, J. W. Drijfhout, P. S. Hiemstra, A. El Ghalbzouri, P. H. Nibbering LL-37-Derived Peptides Eradicate Multidrug-Resistant Staphylococcus aureus from Thermally Wounded Human Skin Equivalents
- J. Overhage, A. Campisano, M. Bains, E. C. W. Torfs, B. H. A. Rehm, R. E. W. Hancock Human Host Defense Peptide LL-37 Prevents Bacterial Biofilm Formation
- A. Sol, O. Ginesin, S. Chaushu, L. Karra, S. Coppenhagen-Glazer, I. Ginsburg, G. Bachrach LL-37 Opsonizes and Inhibits Biofilm Formation of Aggregatibacter actinomycetemcomitans at Subbactericidal Concentrations
- Scott N Dean, Barney M Bishop, Monique L van Hoek Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm activity against Staphylococcus aureus
- Ryan J. Blower, Stephanie M. Barksdale, Monique L. van Hoek Snake Cathelicidin NA-CATH and Smaller Helical Antimicrobial Peptides Are Effective against Burkholderia thailandensis
M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.
Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com