General
| Name: | D-LL-37 |
| Sequence: | [LL-37, 37 aa] |
| Size: | 37 |
| AMP source: | de novo |
| Notes: | mimetic of LL-37 in which every amino acid was changed to the D-form |
| Tags: |
Peptide attributes
| Name | Value |
|---|---|
| NetCharge@5 | 6.521 |
| NetCharge@7 | 5.98 |
| Isoelectric Point | 11.347 |
| Molecular Weight | 4490.58 |
| Extinction Coefficient | 0 |
| Hydrophobicity (CCS) | -0.116 |
| Hydrophobic Mom (CCS) | 3.748 |
Peptide experiments
References
- Scott N Dean, Barney M Bishop, Monique L van Hoek Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm activity against Staphylococcus aureus
- Ryan J. Blower, Stephanie M. Barksdale, Monique L. van Hoek Snake Cathelicidin NA-CATH and Smaller Helical Antimicrobial Peptides Are Effective against Burkholderia thailandensis
M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.
Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com