General
Name: | Scrambled LL-37 |
Sequence: | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
Size: | 37 |
AMP source: | de novo |
Notes: | same charge and net amino acid composition as LL-37, but lacking significant elical character |
Tags: |
Peptide attributes
Name | Value |
---|---|
NetCharge@5 | 6.521 |
NetCharge@7 | 5.98 |
Isoelectric Point | 11.347 |
Molecular Weight | 4490.58 |
Extinction Coefficient | 0 |
Hydrophobicity (CCS) | -0.27 |
Hydrophobic Mom (CCS) | 1.131 |
Peptide experiments
-
MicroorganismData
References
- A. Sol, O. Ginesin, S. Chaushu, L. Karra, S. Coppenhagen-Glazer, I. Ginsburg, G. Bachrach LL-37 Opsonizes and Inhibits Biofilm Formation of Aggregatibacter actinomycetemcomitans at Subbactericidal Concentrations
- Scott N Dean, Barney M Bishop, Monique L van Hoek Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm activity against Staphylococcus aureus
- Ryan J. Blower, Stephanie M. Barksdale, Monique L. van Hoek Snake Cathelicidin NA-CATH and Smaller Helical Antimicrobial Peptides Are Effective against Burkholderia thailandensis
M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.
Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com