General


Name: beta-Defensin 3
Sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Size: 45
AMP source: human
Notes:
Tags:

Peptide attributes


Name Value
NetCharge@5 11.26
NetCharge@7 10.792
Isoelectric Point 10.629
Molecular Weight 5157.717
Extinction Coefficient 3730
Hydrophobicity (CCS) -0.22
Hydrophobic Mom (CCS) 1.273

Peptide experiments


Found 5 experiments
  • Microorganism
    Data
  • Staphylococcus epidermidis ATCC 35984
    4
  • Staphylococcus aureus ATCC 43300
    4
  • Staphylococcus epidermidis MRSE287
    2
  • Cryptococcus neoformans B3501
    1
  • Candida albicans CAI-4
    1

References



M. Di Luca, G. Maccari, G. Maisetta, G. Batoni BaAMPs: the database of biofilm-active antimicrobial peptides Biofouling 2015; 31(2):193-9.

Please do not hesitate to address comments or questions to: mariagrazia.diluca@nano.cnr.it or gpmaccari@gmail.com